Color Printing Services In Indore
(231 products)
Color Rotogravure Printing Services
Product DescriptionColor Rotogravure Printing Services
Durrant Packagers India Private Limited
Indore
Trusted Seller
Premium Seller3 Years
Single Color Bill Book Printing Service
Price: 120 INR/Piece
MOQ10 Piece/Pieces
Product DescriptionSingle Color Bill Book Printing Service
Leaflet Printing Service - Customizable Printing Options Tailored Design to Meet Client Needs Convenient Home Delivery
Printing SideCustomer's demand
Printing TypeCustomer's demand
Service LocationIndore
Paper TypeVarious
Paper SizeCustomizable
Color OptionsFull color
Multicolor Printing Services - High-Quality Offline Solutions | Precision Color Clarity Versatile Design Options Nationwide Accessibility
Printing MethodOffset
ColorsMulticolor
MaterialsVarious
Size RangeVariable
UsagePrinting of leafletspostersbannersflyerspamphletsstickershoardings etc.
Turnaround TimeQuick
Multicolor Printing Service - High Quality Vibrant Designs | Exclusive and Affordable Options
Printing MethodOffset
Color CountMulticolor
Paper SizesCustomizable
Paper TypesVarious
Finishing OptionsMultiple
UsageBrochures flyers posters and marketing materials.
Color Printing CMYK Services
Color ModeCMYK
Paper TypesVarious
Print Resolution300 DPI
File FormatsPDF AI
FinishesMany options
UsageMarketing materials brochures business cards flyers and posters.
Print T Shirt Service
MaterialCotton
ColorLime Green
SizeM-XL
StyleRound Neck
SleeveShort
UsagePromotional events team uniforms casual wear
Multi-Color Printing Services - Premium Quality Materials Custom Sizes Available Vibrant Colors - Business Cards Brochures Marketing Collateral CD Covers & More
Color ModeFull color
Paper TypesVarious
Finishing OptionsMany
Print MethodOffset
File FormatsMultiple
UsageBusiness cards brochures catalogs marketing materials CD covers stickers magazines books advertisements
Curtain Printing Service
MaterialCotton Blend
Printing MethodDigital
Color OptionsMultiple
Size RangeCustomizable
Design OptionsUnlimited
UsageHome or office decoration Light filtering Privacy enhancement
Shree Shyam Dyeing & Printing Mills
Ankleshwar
Colored Booklet Printing Services
Paper TypeVarious
Color OptionsFull color
BindingSaddle Stitch
Page Count10-100+
Size RangeA5-A4
FinishingTrimming
Full Color Letterhead Printing Service - High-Quality 80gsm Paper Customizable Size 8.5x11 inches | Offset Printing with CMYK Colors Folding and Binding Finishing
Paper TypeVarious Options
Paper Weight80gsm-250gsm
Dimensions8.5x11 inches
Color ModeCMYK
Ink TypeHigh-Quality Ink
Printing MethodOffset/Digital
Inkjet Printing Service - High-Quality Fast-Drying Images | Multi-Disciplinary Process Minimal Waste No Cleanup
Print MethodInkjet
MaterialSilk
DimensionsVariable
Color FastnessExcellent
ResolutionHigh
UsageSilk scarf printing service Surat Gujarat India
FAQs Related to Color Printing Services In Indore
How many color printing services products are available in Indore?
Where can I find color printing services nearby Indore?
What are some related categories to color printing services in Indore?
Can I trust the Indore Based Color Printing Services suppliers listed on Tradeindia?
How many Indore based Color Printing Services manufacturers are there?
What is the price range of color printing services in Indore?
| Company Name | Currency | Product Name | Price |
|---|---|---|---|
| - | - | Single Color Bill Book Printing Service | 120 INR (Approx.) |
| - | - | Leaflet Printing Service | 1 INR (Approx.) |
| - | - | Full Color Letterhead Printing Services | nan INR (Approx.) |
| - | - | Four Color Printing Service | 2000 INR (Approx.) |
| - | - | Color Booklet Printing Services | 10 INR (Approx.) |
| - | - | Custom Fabric Digital Printing Services | 150 INR (Approx.) |
| - | - | Colour Separation Service | 200 INR (Approx.) |
What is the delivery time for color printing services in Indore?
How many trusted sellers are available for Color Printing Services in Indore?
Digital Color Printing - High-Quality Materials Custom Sizes Available Vivid Colors | Professional Business Cards Brochures Flyers and Marketing Collateral Solutions
Printing ProcessDigital
Color ModeCMYK
Paper TypesMany options
FinishesVarious
File FormatsMultiple
Turnaround Time1-3 days
CMYK Color Laser Printing Services
Printing MethodLaser CMYK
Paper WeightUp to 300 GSM
Color ModeCMYK
Print SizeCustomizable
Finishing OptionsVarious
UsageCertificates invitations greetings brochures proofs stickers
Four Color Printing Service - Digital & Offset Printing with Supreme Quality Ink Timely Delivery & Professional Designing
Printing TypeDigital & Offset
ColorsFour-color
Service ModeOffline
LocationNashik India
Ink TypeCMYK
Paper SupportVarious
Designing & Multicolor Printing Service
Design SoftwareAdobe Illustrator
Printing ProcessOffset printing
Color OptionsFull color
Paper StockVarious
Finishing OptionsDie cut
Size RangeCustom
Color Sticker Printing Services
Product DescriptionBeing a well renowned firm in the domain we are providing Color Sticker Printing Services in Nagpur Maharashtra India. Our offered services are completed at our advanced manufactured unit which is established with advanced printing machines. To obtain the customers satisfaction our auditors also
Envelope Printing Services - High-Quality Paper Custom Designs & Color Combinations | Professional Advertising Solutions
MaterialPaper
SizeVariable
ColorWhite
PrintingFull-color
FinishMatte
UsageBusiness mailings direct marketing corporate communications
Full Color Brochure Printing Services
Paper StockVarious Options
Printing MethodOffset
Color ProcessCMYK
Finishing OptionsFolding Binding
Size RangeCustomizable
UsageMarketing & Promotions
Four Color Bag Offset Printing Service
Printing MethodOffset
ColorsFour color
MaterialNon-woven
Size RangeVariable
Handle TypeAttached
UsageRetail shopping promotional events product packaging
Multi Color Lahariya Print Fabric Printing Services
MaterialCotton
Print TypeLahariya
ColorsMulticolor
Width44"
Weight150 gsm
UsageGarments home decor and fashion accessories.
Form Printing Service
MaterialPaper
Printing TypeOffset
DesignCustomized
Mode of ServiceOffline
Service TypeForm Printing
SizeVariable
Swarom Digital Media
Thane West, Bhiwandi
2 Years
Multi Color Fabric Digital Printing Service
Printing TypeDigital
LocationPan India
PatternCustom
ColorOrange
UnitsCustom
MaterialFabric
Color Booklet Printing Services
Price: 10 INR/Piece
MOQ3000 Piece/Pieces
Supply Ability200000 Per Week
Delivery Time7 Days
Main Export Market(s)Africa Eastern Europe Western Europe Asia South America Middle East Central America North America Australia
Vihaa Print And Pack Private Limited
Vasai
Trusted Seller
Super Seller8 Years
Custom Fabric Digital Printing Services
Printing MethodDigital
Resolution1440 dpi
Color GamutWide
Fabric TypesCottonPolyester
Minimum Order10 yards
Turnaround Time3-5 days
Colour Separation Service
Printing MethodDigital printing
Color OptionsFull color
Material SupportPlastic bags
Design TypesFloral paisley
File FormatsAI PDF
UsagePlastic bag decorationbrandingpromotion
Digital Print Point
Vashi, Navi Mumbai
Popular Categories in Indore
Popular Products
 
© 1999-2026 Infocom Network Private Limited. All rights reserved.